PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P10240_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family ARF
Protein Properties Length: 620aa    MW: 69463.1 Da    PI: 7.6146
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P10240_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.2e-23150251199
                            EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                     B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                            f+k+lt sd++++g +++p++ ae++       ++++++  +l+++d++  sW++++i+r++++r++lt+GW+ Fv  ++L +gD+v+
  GSMUA_Achr3P10240_001 150 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELVVKDLHDVSWTFRHIFRGQPKRHLLTTGWSVFVGTKRLSAGDSVL 235
                            99*****************************96555544..8********************************************** PP

                            EEE-SSSEE..EEEEE-S CS
                     B3  82 Fkldgrsefelvvkvfrk 99 
                            F   ++++ +l+++++r+
  GSMUA_Achr3P10240_001 236 FI--RDEKLQLLFGMRRA 251
                            **..5699999**99997 PP

2Auxin_resp120.11.7e-39276358183
             Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                            aahaa+++s+F+++ nPras+seFv++++k++ka++++vs+GmRf+m+fetedss rr++Gtv+g+sdldpvrW+nS+W +L+
  GSMUA_Achr3P10240_001 276 AAHAATNNSPFTIFCNPRASPSEFVIPFAKYNKAMYTQVSLGMRFRMMFETEDSSVRRYMGTVTGISDLDPVRWKNSQWHNLQ 358
                            79******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-43140279IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.8E-40143265IPR015300DNA-binding pseudobarrel domain
CDDcd100178.69E-20149241No hitNo description
SMARTSM010193.4E-22150252IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196150252IPR003340B3 DNA binding domain
PfamPF023624.5E-21150251IPR003340B3 DNA binding domain
PfamPF065071.2E-34276358IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MDKILFIIHE NKYKTYKIIQ HVDHFYKSIP PWRVPHPLKP QGIIDSELWH ACAGPLVSLP  60
PVGSLVVYFP QGHSEQVAAS MQKEINDIPK YPSLPSKLIC VLLDVTMHAD AETDEVYAQM  120
TLQPVNKYDR EAMLASEMGL KQNKHPAEFF CKTLTASDTS THGGFSVPRR AAEKIFPPLD  180
FTMQPPAQEL VVKDLHDVSW TFRHIFRGQP KRHLLTTGWS VFVGTKRLSA GDSVLFIRDE  240
KLQLLFGMRR ANRQQPALSS SVLSSDSMHI GILAAAAHAA TNNSPFTIFC NPRASPSEFV  300
IPFAKYNKAM YTQVSLGMRF RMMFETEDSS VRRYMGTVTG ISDLDPVRWK NSQWHNLQVG  360
WDESTATERR TRVSIWEIEP LATPFYLCPP PFFRRNFPEA PGVPDAHEVE NAFQRVMPWL  420
NDDYGIKDTQ SALFPGLSLV QWMSMQQNHQ LMTPAAQPAH FPSAIASALQ NGLLLPQASA  480
SHHVQLPPLQ QKSINLQQQQ FQQQEQGQLQ QPQSQPQPQQ LRPVAVQEAA DHQLMQHQTS  540
SGQIVSQTHS SSQHLQPSLL QLQELQSSST IALSAQSIIA ISVAAASSST KSAVSRAAGF  600
TTAVFTQWDQ GSIFIELSFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1694337950388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391721.10.0PREDICTED: auxin response factor 16-like isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLM0SDE10.0M0SDE1_MUSAM; Auxin response factor
STRINGGSMUA_Achr3P10240_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140935106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19